GJB1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 81-130 of Human Connexin 32. |
GJB1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 81-130 of Human Connexin 32. |
Rabbit Polyclonal Anti-GJB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR |
Rabbit Polyclonal Anti-GJB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Rabbit Polyclonal Anti-Connexin 32 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |