Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHKG2 |
Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHKG2 |
Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV |