Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit Polyclonal Anti-RAB4B Antibody
| Reactivities | Human, Mouse, Pig, Dog, Horse, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB4B antibody is: synthetic peptide directed towards the middle region of Human RAB4B. Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE |
USD 520.00
2 Weeks
Goat Polyclonal Anti-CHRNA7 Antibody
| Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CHRNA7 Antibody: Peptide with sequence KRPGEDKVRPACQHKQ, from the internal region of the protein sequence according to NP_000737.1. |
Goat Anti-ADRA2A Antibody
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TERRPNGLGPERS, from the internal region of the protein sequence according to NP_000672.2. |
Rabbit anti Osteopontin Polyclonal Antibody
| Reactivities | Human, Pig, Dog |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China