Rabbit polyclonal anti-CD79A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Rabbit polyclonal anti-CD79A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Rabbit Polyclonal Anti-HAO1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD79A |
Rabbit Polyclonal Anti-CD79A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG |
Rabbit anti CD79a Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |