Antibodies

Jump to Filters
View as table Download
FDPS Rabbit Polyclonal Antibody
TA332880

USD 365.00

3 Weeks

Rabbit anti-FDPS Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FDPS
MVK Rabbit Polyclonal Antibody
TA335150

USD 539.00

5 Days

Rabbit polyclonal Anti-MVK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVK antibody: synthetic peptide directed towards the N terminal of human MVK. Synthetic peptide located within the following region: LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA
MVK Rabbit Polyclonal Antibody
TA335151

USD 539.00

5 Days

Rabbit polyclonal Anti-MVK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVK antibody: synthetic peptide directed towards the middle region of human MVK. Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP
HMGCS2 Rabbit Polyclonal Antibody
TA346113

USD 485.00

5 Days

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE