USD 447.00
In Stock
GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 564.00
4 Weeks
Carrier-free (BSA/glycerol-free) GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GNAI1 mouse monoclonal antibody,clone OTI2D1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GNAI1 mouse monoclonal antibody,clone OTI2D1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-GNAI1 Antibody
Applications | WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
USD 200.00
In Stock
GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 580.00
5 Days
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2. |