Antibodies

View as table Download

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRLF2

Rabbit Polyclonal TSLP Receptor Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor.

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF

CRLF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-231 of human CRLF2 (NP_071431.2).
Modifications Unmodified