Antibodies

View as table Download

UBE2I Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2I

Rabbit polyclonal anti-UBE2I Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2I

Rabbit polyclonal anti-UBE2I Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2I

Goat Polyclonal Antibody against UBE2I

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence SGIALSRLAQERK-C, from the N Terminus of the protein sequence according to NP_003336.1; NP_919235.1; NP_919236.1; NP_919237.1.

Rabbit Polyclonal Anti-SLC38A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC38A4 antibody: synthetic peptide directed towards the middle region of human SLC38A4. Synthetic peptide located within the following region: LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV