Rabbit polyclonal anti-RAD21 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD21. |
Rabbit polyclonal anti-RAD21 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD21. |
Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN |
Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG |