Antibodies

Jump to Filters
View as table Download
PPP3CB Mouse Monoclonal Antibody [Clone ID: OTI2E4]
TA809772

USD 447.00

In Stock

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP3CB Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF809772

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP3CB Rabbit Polyclonal Antibody
TA308439

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)
PTGER3 Rabbit Polyclonal Antibody
TA313293

USD 380.00

In Stock

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.
PPP3CB Mouse Monoclonal Antibody [Clone ID: OTI2E4]
TA809772S

USD 200.00

In Stock

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTGER3 Rabbit Polyclonal Antibody
AP01424PU-N

USD 465.00

3 Weeks

PTGER3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
PTGER3 Rabbit Polyclonal Antibody
TA334750

USD 485.00

5 Days

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the C terminal of human PTGER3. Synthetic peptide located within the following region: LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER
PTGER3 Goat Polyclonal Antibody
TA303309

USD 520.00

5 Days

Goat Polyclonal Antibody against PTGER3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KLLREPCSVQLS, from the C Terminus of the protein sequence according to NP_000948.2; NP_942005.2; NP_942006.1.
PTGER3 Rabbit Polyclonal Antibody
TA334748

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL
PTGER3 Rabbit Polyclonal Antibody
TA334749

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
PTGER3 Rabbit Polyclonal Antibody
TA334751

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE
PPP3CB Rabbit Polyclonal Antibody
TA360186

USD 539.00

5 Days

PPP3CB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3CB