Anti-NTF4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4 |
Anti-NTF4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4 |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Anti-NGF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide) |
Anti-BDNF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide mapping at the middle region of Human Neurotrophin-3 |
Rabbit Polyclonal Anti-NGF beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta |
BDNF rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide mapping at the middle region of human BDNF |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
Rabbit Polyclonal Anti-FASL Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit anti-NGF Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NGF |