Antibodies

View as table Download

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYT

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA

NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated