Germany
Japan
United Kingdom
China
Rabbit anti-BMP7 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP7 |
Antibodies
View as table Download
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
| Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human KIT. |
Rabbit Polyclonal c-Kit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Partial recombaint protein |
Rabbit Polyclonal Anti-PDGFC Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pdgfc antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdgfc. Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV |
Rabbit Polyclonal Anti-PDGFC Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS |
Rabbit Polyclonal Anti-GDF5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Active filters
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG
Families
- Embryonic stem cells
Pathways
- Cytokine-cytokine receptor interaction