USD 509.00
2 Weeks
CSF2RA mouse monoclonal antibody,clone OTI3E6, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
CSF2RA mouse monoclonal antibody,clone OTI3E6, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
CSF2RA mouse monoclonal antibody,clone OTI3E6, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 200.00
2 Days
CSF2RA mouse monoclonal antibody,clone OTI2B2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 200.00
2 Days
CSF2RA mouse monoclonal antibody,clone OTI2D6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 200.00
2 Days
CSF2RA mouse monoclonal antibody,clone OTI2E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CSF2RA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 23-320 amino acids of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) |
Rabbit polyclonal anti-CSF2RA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CSF2RA. |
Rabbit Polyclonal Anti-CSF2RA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSF2RA antibody is: synthetic peptide directed towards the C-terminal region of Human CSF2RA. Synthetic peptide located within the following region: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW |
USD 200.00
2 Days
CSF2RA mouse monoclonal antibody,clone OTI3E6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |