Germany
Japan
United Kingdom
China
Antibodies
View as table Download
HACE1 mouse monoclonal antibody,clone OTI3F5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HACE1 mouse monoclonal antibody,clone OTI4F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HACE1 mouse monoclonal antibody,clone OTI2C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HACE1 mouse monoclonal antibody,clone OTI10D3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HACE1 mouse monoclonal antibody,clone OTI3F5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HACE1 mouse monoclonal antibody,clone OTI4F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HACE1 mouse monoclonal antibody,clone OTI2C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HACE1 mouse monoclonal antibody,clone OTI10D3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HACE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1. Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV |
Active filters
Target Symbol
- HACE1
Applications
- WB
Conjugates
- Unconjugated