Anti-STX1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Anti-STX1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Rabbit Polyclonal Anti-VAMP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VAMP2 |
Rabbit Polyclonal Anti-VAMP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VAMP1 |
Anti-STX1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Rabbit Polyclonal Syntaxin 1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A |
Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-VAMP1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Vamp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Vamp1. Synthetic peptide located within the following region: MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRV |
Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D) |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-STX1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV |