Rabbit polyclonal anti-MOK antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MOK. |
Rabbit polyclonal anti-MOK antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MOK. |
Rabbit polyclonal anti-OR5AK3P antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR5AK3P. |
Rabbit Polyclonal Anti-PAFAH1B3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAFAH1B3 antibody: synthetic peptide directed towards the middle region of human PAFAH1B3. Synthetic peptide located within the following region: GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN |
Rabbit Polyclonal Anti-RAGE Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAGE antibody: synthetic peptide directed towards the middle region of human RAGE. Synthetic peptide located within the following region: TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR |
Rabbit Polyclonal Anti-RAGE Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAGE antibody: synthetic peptide directed towards the N terminal of human RAGE. Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL |
Rabbit Polyclonal Anti-MOK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MOK Antibody: A synthesized peptide derived from human MOK |