Antibodies

View as table Download

Rabbit Polyclonal Anti-C1galt1c1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-C1galt1c1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat C1galt1c1. Synthetic peptide located within the following region: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT

C1GALT1C1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1).
Modifications Unmodified