Rabbit anti-PSMB4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMB4 |
Rabbit anti-PSMB4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMB4 |
Rabbit polyclonal Anti-PSMB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV |
Rabbit polyclonal Anti-PSMB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ |