Anti-ALDH6A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1 |
Anti-ALDH6A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1 |
Anti-ALDH6A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1 |
Rabbit Polyclonal Antibody against ALDH6A1 (C-term)
Applications | IHC, WB |
Reactivities | Human (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1. |
Goat Anti-ALDH6A1 (aa487-496) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1. |
Rabbit Polyclonal Anti-ALDH6A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW |
Rabbit Polyclonal Anti-ALDH6A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID |