Rabbit Polyclonal Anti-HOXB4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB4 |
Rabbit Polyclonal Anti-HOXB4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB4 |
Rabbit Polyclonal Anti-HOXB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: AMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPE |
Rabbit Polyclonal Anti-HOXB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG |
Rabbit Polyclonal Anti-HOXB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the C terminal of human HOXB4. Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA |