Antibodies

Jump to Filters
View as table Download
Bcl x (BCL2L1) Mouse Monoclonal Antibody [Clone ID: OTI2D1]
TA506188

USD 447.00

In Stock

BCL2L1 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD130 (IL6ST) Mouse Monoclonal Antibody [Clone ID: B-P4]
AM31176AF-N

USD 370.00

2 Weeks

CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free

Applications FC, FN, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Bcl x (BCL2L1) Mouse Monoclonal Antibody [Clone ID: OTI2D1]
TA506188S

USD 200.00

In Stock

BCL2L1 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IL7R alpha (IL7R) Rabbit Polyclonal Antibody
TA327014

USD 365.00

2 Weeks

Rabbit anti-IL7R Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL7R
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA323722

USD 380.00

2 Weeks

Anti-GHR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 48-63 amino acids of Human growth hormone receptor
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA334654

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHR antibody: synthetic peptide directed towards the N terminal of human GHR. Synthetic peptide located within the following region: LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF