Antibodies

Jump to Filters
View as table Download
FUS2 (NAT6) Mouse Monoclonal Antibody [Clone ID: AT2F4]
AM09137PU-N

USD 430.00

3 Weeks

FUS2 (NAT6) mouse monoclonal antibody, clone AT2F4, Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
FUS2 (NAT6) Mouse Monoclonal Antibody [Clone ID: AT2F4]
AM09137PU-S

USD 315.00

3 Weeks

FUS2 (NAT6) mouse monoclonal antibody, clone AT2F4, Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
FUS2 (NAT6) Rabbit Polyclonal Antibody
TA346764

USD 539.00

5 Days

Rabbit Polyclonal Anti-NAT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6. Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP