FUS2 (NAT6) mouse monoclonal antibody, clone AT2F4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
FUS2 (NAT6) mouse monoclonal antibody, clone AT2F4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
FUS2 (NAT6) mouse monoclonal antibody, clone AT2F4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NAT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6. Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP |