Antibodies

View as table Download

Rabbit Polyclonal Anti-STAG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STAG2

SA2 (STAG2) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRGSTVRSKKSKPST, from the internal region of the protein sequence according to NP_001036214.1; NP_006594.3.

Goat Polyclonal Antibody against STAG2

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REPKRLRPEDS, from the internal region of the protein sequence according to NP_001036214.1; NP_001036215.1 ; NP_001036216.1 ; NP_006594.3.

Rabbit Polyclonal Anti-STAG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAG2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAG2. Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

STAG2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human STAG2

STAG2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human STAG2