Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ATF5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF5. |
Antibodies
View as table Download
ATF5 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 187-216 amino acids from the C-terminal region of human ATF5 |
Goat Anti-ATF5 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EVYKARSQRTRSC, from the C Terminus of the protein sequence according to NP_036200.2. |
Rabbit Polyclonal anti-ATF5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATF5 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF5. Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL |
Rabbit Polyclonal Anti-Atf5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atf5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Atf5. Synthetic peptide located within the following region: EGEALEGECQGLEARNRELRERAESVEREIQYVKDLLIEVYKARSQRTRS |
Rabbit Polyclonal Anti-ATF5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF5 antibody: synthetic peptide directed towards the middle region of human ATF5. Synthetic peptide located within the following region: LPPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRK |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ATF5
Applications
- WB
Families
- Transcription Factors