ACAD8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 125~154 amino acids from the Central region of human ACAD8 |
ACAD8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 125~154 amino acids from the Central region of human ACAD8 |
Rabbit polyclonal antibody to ACAD8 (acyl-Coenzyme A dehydrogenase family, member 8)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Pig, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 415 of ACAD8 (Uniprot ID#Q9UKU7) |
Rabbit Polyclonal Anti-ACAD8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAD8 antibody is: synthetic peptide directed towards the N-terminal region of Human ACAD8. Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV |