ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal ECT2 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
ECT2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 565-594 amino acids from the Central region of Human ECT2. |
Rabbit polyclonal ECT2 phospho T790 antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat, Zebrafish, Chimpanzee, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 785-795 of human ECT2 protein. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ECT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL |
Rabbit Polyclonal Anti-ECT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG |
ECT2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human ECT2 |
ECT2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ECT2. |
Modifications | Unmodified |