Antibodies

View as table Download

IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-IFNGR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNGR2

IFNGR2 (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human IFNGR2

Rabbit Polyclonal Anti-IFNGR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNGR2 antibody: synthetic peptide directed towards the middle region of human IFNGR2. Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL

IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated