Antibodies

Jump to Filters
View as table Download
CYP11B2 Rabbit Polyclonal Antibody
TA346195

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B2 antibody: synthetic peptide directed towards the middle region of human CYP11B2. Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
CYP11B2 Rabbit Polyclonal Antibody
TA360059

USD 539.00

5 Days

CYP11B2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CYP11B2