Rabbit polyclonal anti-GPR142 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR142. |
Rabbit polyclonal anti-GPR142 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR142. |
GPR142 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 93-122 amino acids from the N-terminal region of human GPR142 |
Goat Anti-GPR142 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DMWRDTDSPRTLD, from the internal region of the protein sequence according to NP_861455.1. |
Rabbit Polyclonal Anti-GPR142 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR142 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR142. Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH |