Antibodies

View as table Download

MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF