UTP18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UTP18 |
UTP18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UTP18 |
UTP18 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UTP18 |
Rabbit Polyclonal Anti-UTP18 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UTP18 antibody: synthetic peptide directed towards the N terminal of human UTP18. Synthetic peptide located within the following region: PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE |