Antibodies

View as table Download

UTP18 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UTP18

UTP18 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UTP18

Rabbit Polyclonal Anti-UTP18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UTP18 antibody: synthetic peptide directed towards the N terminal of human UTP18. Synthetic peptide located within the following region: PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE