Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PNLIP |
Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Pig, Rabbit, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233) |
Rabbit anti-LIPC Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIPC |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |