Rabbit Polyclonal Antibody against YAP
Applications | ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant YAP protein expressed in bacteria. |
Rabbit Polyclonal Antibody against YAP
Applications | ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant YAP protein expressed in bacteria. |
Mouse Monoclonal YAP1 Antibody (1A12)
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-YAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |