Antibodies

View as table Download

Rabbit Polyclonal Antibody against YAP

Applications ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant YAP protein expressed in bacteria.

Mouse Monoclonal YAP1 Antibody (1A12)

Applications ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
TA336916 is a replacement of AM06727PU-N.

Rabbit Polyclonal Anti-YAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS