Rabbit polyclonal PFKL Antibody (C-term L684)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL. |
Rabbit Polyclonal Anti-TKTL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI |
PFKL rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
