Antibodies

View as table Download

Mouse Monoclonal beta-Catenin Antibody (12F7)

Applications FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Chicken, Primate
Conjugation Unconjugated

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Rabbit Polyclonal Anti-WNT1 Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Chicken)
Conjugation Unconjugated
Immunogen WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%).

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Mouse, Rat, Bat, Bovine, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Guinea Pig)
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).

beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Rat
Conjugation Unconjugated