Rabbit Polyclonal Anti-ENDOG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENDOG |
Rabbit Polyclonal Anti-ENDOG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENDOG |
Rabbit Polyclonal EndoG Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EndoG antibody was raised with a synthetic peptide corresponding to 15 amino acids near the amino terminus of human EndoG. The immunogen is located within amino acids 40 - 90 of EndoG. |
Endo G (ENDOG) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ENDOG |
Rabbit Polyclonal Anti-ENDOG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENDOG antibody: synthetic peptide directed towards the middle region of human ENDOG. Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS |