Antibodies

View as table Download

Rabbit Polyclonal Anti-ENDOG Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ENDOG

Rabbit Polyclonal EndoG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EndoG antibody was raised with a synthetic peptide corresponding to 15 amino acids near the amino terminus of human EndoG. The immunogen is located within amino acids 40 - 90 of EndoG.

Endo G (ENDOG) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human ENDOG

Rabbit Polyclonal Anti-ENDOG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENDOG antibody: synthetic peptide directed towards the middle region of human ENDOG. Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS