PAK4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAK4 |
PAK4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAK4 |
Rabbit Polyclonal PAK4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PAK4 antibody was raised against a 13 amino acid peptide from near the center of human PAK4. |
PAK4 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human PAK4 (NP_001014831.1). |
Modifications | Unmodified |
PAK4 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human PAK4. |
Phospho-PAK4/5/6 (Ser474/Ser560/Ser602) Rabbit polyclonal Antibody
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Phospho-PAK4 + PAK5 + PAK6 (S474 + S560 + S602) (Phosphorylated) |
PAK4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Pak4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR |
Rabbit Polyclonal Anti-PAK4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PAK4 antibody is: synthetic peptide directed towards the middle region of Human PAK4. Synthetic peptide located within the following region: EPQLAPPACTPAAPAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDP |
Rabbit anti PAK4(pS474) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding the epitope RKSLV-with a phosphorylation at Serine 474 of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |
Rabbit anti PAK4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from internal sequence of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |