Antibodies

Jump to Filters
View as table Download
PDE1A Rabbit Polyclonal Antibody
TA363737

USD 539.00

5 Days

PDE1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A
ADCY5 Rabbit Polyclonal Antibody
TA363757

USD 539.00

5 Days

ADCY5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADCY5
GUCY1B1 Rabbit Polyclonal Antibody
TA356597

USD 539.00

5 Days

GUCY1B1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS