Rabbit Polyclonal Anti-FGF16 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FGF16 |
Rabbit Polyclonal Anti-FGF16 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FGF16 |
Rabbit Polyclonal Anti-FGF16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF16 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF16. Synthetic peptide located within the following region: REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH |