Rabbit Polyclonal Anti-PTPRC Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PTPRC |
Rabbit Polyclonal Anti-PTPRC Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PTPRC |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
Modifications | Phospho-specific |
Rabbit anti-PTPRC Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PTPRC |
PTPRM Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Monkey, Bat, Bovine) |
Conjugation | Unconjugated |
Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
Rabbit Polyclonal Anti-PTPRM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPRM antibody is: synthetic peptide directed towards the middle region of Human PTPRM. Synthetic peptide located within the following region: QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG |
Rabbit anti CD45/LCA Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein encoding aa 1119-1304 of human CD45. |