Antibodies

View as table Download

Rabbit Polyclonal Anti-APMAP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APMAP

Rabbit Polyclonal Anti-APMAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APMAP antibody: synthetic peptide directed towards the N terminal of human APMAP. Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Rabbit Polyclonal Anti-APMAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APMAP antibody: synthetic peptide directed towards the C terminal of human APMAP. Synthetic peptide located within the following region: QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL