Rabbit Polyclonal Anti-PIDD1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PIDD1 |
Rabbit Polyclonal Anti-PIDD1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PIDD1 |
Rabbit Polyclonal Anti-LRDD Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LRDD antibody: synthetic peptide directed towards the middle region of human LRDD. Synthetic peptide located within the following region: RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE |
Rabbit Polyclonal Anti-LRDD Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LRDD antibody: synthetic peptide directed towards the N terminal of human LRDD. Synthetic peptide located within the following region: RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA |