Rabbit Polyclonal TMP21 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TMP21 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TMP21. |
Rabbit Polyclonal TMP21 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TMP21 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TMP21. |
Rabbit Polyclonal Tmp21/p23 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 100-200). [Swiss-Prot# P49755] |
Rabbit Polyclonal Tmp21/p23 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate, Rabbit, Xenopus |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 50-150). [Swiss-Prot# P49755] |
Rabbit Polyclonal TMP21 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TMP21 antibody was raised against a 18 amino acid peptide from near the center of human TMP21. |
Rabbit Polyclonal Anti-TMED10 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMED10 antibody: synthetic peptide directed towards the middle region of human TMED10. Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF |
TMED10 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human TMED10 |