Rabbit Polyclonal Anti-DUSP22 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP22 |
Rabbit Polyclonal Anti-DUSP22 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP22 |
Rabbit polyclonal anti-DUSP22 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DUSP22. |
Rabbit Polyclonal Anti-DUSP22 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DUSP22 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP22. Synthetic peptide located within the following region: LPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADS |
Rabbit Polyclonal Anti-DUSP22 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | DUSP22 / JSP 1 antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human DUSP22. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit (100%); Mouse, Rat (94%); Elephant, Chicken (88%); Xenopus (82%). |
DUSP22 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human DUSP22 |