Rabbit Polyclonal CDC25C (Ser216) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25C around the phosphorylation site of Serine 216 |
| Modifications | Phospho-specific |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit Polyclonal Cdc25C Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Anti-CDC25A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 376-482 amino acids of human cell division cycle 25 homolog A (S. pombe) |
Rabbit Polyclonal CDC25B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B |
Rabbit Polyclonal CDC25B (Ser353) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 353 |
| Modifications | Phospho-specific |
CDC25C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25C |
Rabbit anti-cdc25A (Phospho-Ser75) polyclonal antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humancdc25A around the phosphorylation site of serine 75 (M-G-SP-S-E). |
| Modifications | Phospho-specific |
Rabbit anti-CDC25A polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humancdc25A around the phosphorylation site of serine 75. |
Rabbit Polyclonal Anti-Cdc25b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK |
Rabbit Polyclonal Anti-Phospho-CDC25A(Ser75) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-CDC25A(Ser75) Antibody: A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75 |
| Modifications | Phospho-specific |
Rabbit anti CDC25C(pS216) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ser82) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 82. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-CDC25A (Thr507) Antibody (Phospho-specific)
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Threonine 507 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China