COQ6 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human COQ6 |
COQ6 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human COQ6 |
Rabbit Polyclonal Anti-COQ6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COQ6 antibody is: synthetic peptide directed towards the N-terminal region of Human COQ6. Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA |
COQ6 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |