Rabbit polyclonal anti-N4BP2L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human N4BP2L2. |
Rabbit polyclonal anti-N4BP2L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human N4BP2L2. |
Rabbit Polyclonal Anti-N4BP2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the N terminal of human N4BP2L2. Synthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN |
Rabbit Polyclonal Anti-N4BP2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the middle region of human N4BP2L2. Synthetic peptide located within the following region: TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP |