Antibodies

Jump to Filters
View as table Download
ATF1 Rabbit Polyclonal Antibody
TA351994

USD 380.00

In Stock

Rabbit Polyclonal Anti-ATF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATF1
ATF1 Rabbit Polyclonal Antibody
TA312188

USD 380.00

4 Weeks

Rabbit polyclonal anti-ATF1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATF1.
ATF1 Rabbit Polyclonal Antibody
AP21087PU-N

USD 445.00

3 Weeks

ATF1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 20-70 of Human ATF1.
ATF1 Rabbit Polyclonal Antibody
TA325230

USD 380.00

In Stock

Rabbit Polyclonal ATF1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ATF1
ATF1 Rabbit Polyclonal Antibody
TA325231

USD 380.00

In Stock

Rabbit Polyclonal ATF1 (Ser63) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ATF1 around the phosphorylation site of Serine 63
Modifications Phospho-specific
ATF1 Rabbit Polyclonal Antibody
TA329248

USD 539.00

5 Days

Rabbit Polyclonal anti-ATF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF1. Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ
ATF1 Rabbit Polyclonal Antibody
TA329249

USD 539.00

5 Days

Rabbit Polyclonal anti-ATF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the middle region of human ATF1. Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR
ATF1 Rabbit Polyclonal Antibody
TA343511

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the N terminal of human ATF1. Synthetic peptide located within the following region: ETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
ATF1 Rabbit Polyclonal Antibody
TA343512

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the C terminal of human ATF1. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV