Rabbit Polyclonal LIM1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal LIM1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MCM6 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal ENOA Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
Conjugation | Unconjugated |
Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal ING1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal c-Fos Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-TBP antibody, Loading control
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal antibody to ARA9 (aryl hydrocarbon receptor interacting protein)
Applications | IF, WB |
Reactivities | Human, Mouse (Predicted: Monkey, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 330 of ARA9 (Uniprot ID#O00170) |
Rabbit polyclonal STAT2 phospho Y690 antibody
Applications | IHC, WB |
Reactivities | Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein. |
Rabbit polyclonal Phospho-p53(T18) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human, Mouse (Predicted: Pig, Monkey, Rabbit) |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
Modifications | Phospho-specific |
Rabbit polyclonal p53 Antibody (S315)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53. |
Rabbit Polyclonal Anti-RAB8A Antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP |
Rabbit polyclonal TERF2IP Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | This TERF2IP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 349-378 amino acids from the C-terminal region of human TERF2IP. |